DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Cht9

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster


Alignment Length:376 Identity:149/376 - (39%)
Similarity:211/376 - (56%) Gaps:32/376 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GTPKIV-CYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPGLY 184
            |..:|| ||:..|:.||...|||...:|.|.||||:.::|..:..|  ...:|.|...|...|..
  Fly    18 GAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDN--GEIQSLDTWLDYDLGFI 80

  Fly   185 ERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYP 249
            .:.::||..|..||:|..:|||:.|:.|:..||...|.||.|:.||:..||..||||||:|||||
  Fly    81 NQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFDGLDLDWEYP 145

  Fly   250 --KGS--DDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFI 310
              :|.  :|:.|||.||:|::|||.....|       |..||..|.......|::..||..:|||
  Fly   146 NQRGGNWNDRANFVTLLREIKEAFAPYGYE-------LGIAVGAGESLASASYEIANIAQQVDFI 203

  Fly   311 NLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFT 375
            |:|.|||....:.:||.|||        :|    :|:||.:.|:..|||..|||:|:.||||||.
  Fly   204 NVMTYDFAMASDGQTGFNAP--------QW----AVENAINFWLSQGAPANKLVLGVGTYGRSFQ 256

  Fly   376 LANPDKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDEMKVPYLVDGDQWVGFD 440
            |::..::.|.||..|.|..|.||...|:|.|.|||:   |....|:|.:...||...|||||.||
  Fly   257 LSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQ---NNWHTVFDYDNAAPYAYSGDQWVSFD 318

  Fly   441 DERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMREEL 491
            :..:::.||.:..|.|..|||:|:::.||::|: ||..  |||:..:..:|
  Fly   319 NVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQ-CGET--YPLLKTINRKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 139/348 (40%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 147/370 (40%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 146/369 (40%)
Glyco_18 23..346 CDD:214753 138/346 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463827
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
98.850

Return to query results.
Submit another query.