DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Idgf5

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster


Alignment Length:448 Identity:102/448 - (22%)
Similarity:180/448 - (40%) Gaps:120/448 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 QVFCYLTSWSAKRPGAGKFQPENIDPKL--CTHIVYAFATLQ--DYK---LTEATDDDPENYESV 616
            ::.|:..:.|..|.|..:.....::|.|  |..:||.:|.:.  .||   |..:..:|.::|..:
  Fly    30 KLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKIKSLDPSLTNDRQHYRHI 94

  Fly   617 IALRDNNPDLQILLAIGG-------WAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVD 674
            .|||...|.::.||::||       ....|..:..|.........|....:..|.:..|:|:|:.
  Fly    95 TALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLAELNNNGFDGIDLA 159

  Fly   675 WEYP-----------------------------RGAEDRVAYVSLLKELRVAFEGEAKSSGLPRL 710
            |::|                             :..|.|..:.:||:||    :.:.:..|  :|
  Fly   160 WQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLEEL----QSDLRRGG--QL 218

  Fly   711 LLTAAVP-ASFEAIAAGYDVPEISKYLDFINVMTYDF----------------HGQWERTVGHNS 758
            |..:.:| .|.|..   .|||::...:||:|:.||||                :..::|...|| 
  Fly   219 LTVSMLPHVSAELF---IDVPKVLSNVDFVNLGTYDFQTPERDPKVADLPTPLYAMYDRDPSHN- 279

  Fly   759 PLFALESATGYQKKLTVDYSAREWVKQGA--PKEKLLIGMPTYGRSFELVNDTQFDIGSP----S 817
                            |.|..:.|:.|.:  ...||.:|:.:|||::.:..::.. .|.|    :
  Fly   280 ----------------VQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTRNSGI-TGYPPIPAA 327

  Fly   818 SGGGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVP--------------FAYR------ 862
            :|....|:.|...|.||:.|:|..|...      ..:::||              :|||      
  Fly   328 NGAAPPGRQTVTPGLLSWPEICDLLQQQ------PQDREVPHLRKVGDPTKRFGIYAYRAADDQG 386

  Fly   863 -GNQWVGFDDERSLKTKTEWLKEQGFGGIMVWSIDMDDFSGRCGSGKYPLLTALNDEL 919
             ...|||::|..:...|..::..||.||:....:.||||.|:|...|:|:|.::..:|
  Fly   387 ENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQCAGEKFPILRSIKFKL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 92/425 (22%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 101/445 (23%)
CBM_14 951..1005 CDD:279884
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 101/446 (23%)
Glyco_18 30..423 CDD:214753 92/425 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.