DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Idgf6

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster


Alignment Length:465 Identity:118/465 - (25%)
Similarity:200/465 - (43%) Gaps:110/465 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SSLKGKKTKVDDGTPK-----IVCYYTNWSQYRVKIGKFVPEDI-PA-DLCTHIIFAFGWLKKNK 166
            :|::..|.    |.|:     :||||.:.|..:..:||.|.::: || ..|.::::.:..::::.
  Fly    14 ASIQASKV----GAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDS 74

  Fly   167 LSSYESNDETK-DNVPGLYERMMTLKKANPKLKILLALGG---------WSFGTQKFKDMSSTRY 221
            ..:...|.:.. |...|||..:..||:..|.:||||::||         ......|:.::..:..
  Fly    75 HKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPT 139

  Fly   222 TRQTFVYSAIPFLRKRGFDGLDMDWEYPK----------GS--------------------DDKK 256
            .|..||.:....::..||||||:.|::||          ||                    :.|:
  Fly   140 GRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKE 204

  Fly   257 NFVLLLKELREAFEAEAQELKKPRLLLSAAV-PVGPDNIRGG--YDVPAIASYLDFINLMAYDFH 318
            .|..||::::.||..:       .||||..| |    |:...  ||:||:.:||||:||..:||.
  Fly   205 QFTALLRDVKNAFRPD-------NLLLSTTVLP----NVNSSLFYDIPAVVNYLDFVNLGTFDFF 258

  Fly   319 GKWERE--TGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDK 381
            ......  ..:.||:|..   ||...:.:|......|::...|..|:.:|:.||||.:.|.  |.
  Fly   259 TPQRNPEVADYAAPIYEL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLT--DD 318

  Fly   382 HG-----------PNAPASGGGREGVYTKEGGFLAYYEICEML-------LNGA----VYVWDDE 424
            .|           ..||..|.      |:..|..::.|:|.:|       |.||    :.|.|..
  Fly   319 SGDTGVPPVKDVKDEAPVGGN------TQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPA 377

  Fly   425 MKVPYLV--------DGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKY 481
            .:.....        |...||.|:|.....:|..::::...||..::.:..|||:| :| .|.||
  Fly   378 KRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LC-TNEKY 440

  Fly   482 PLIGAMREEL 491
            |::.|::..|
  Fly   441 PILRAIKYRL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 103/425 (24%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 113/442 (26%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 113/443 (26%)
Glyco_18 31..429 CDD:214753 103/419 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
54.840

Return to query results.
Submit another query.