DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Idgf1

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster


Alignment Length:440 Identity:114/440 - (25%)
Similarity:195/440 - (44%) Gaps:86/440 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TKVDDGTPKIVCYYTNWSQYRVKIGKFVPE--DIPADLCTHIIFAFGWLKKNKLSSYESNDETKD 178
            |.:......::|||.:.|..|..:.|....  |:....|||:::.:..||...|..:..|   .|
  Fly    15 TSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGTLELFSLN---VD 76

  Fly   179 NVPGLYERMMTLKKANPKLKILLALGG-----WSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRG 238
            .....|:.:..|::..|:|||||::||     .:...:..:.:.:.|..:|.|:.|::..|::.|
  Fly    77 LDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSSMILLKRNG 141

  Fly   239 FDGLDMDWEYPK----------GS--------------------DDKKNFVLLLKELREAFEAEA 273
            |||||:.::.|:          ||                    :.|..|..|:..::.||    
  Fly   142 FDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAF---- 202

  Fly   274 QELKKPRLLLSAAVPVGPD-NIRGGYDVPAIASYLDFINLMAYDFHG--KWERETGHNAPLYAPS 335
               :...|:||  :.|.|: |....:|||.:....|:|||.|:||..  :...|....||::  .
  Fly   203 ---RSANLMLS--LTVLPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEADFTAPIF--F 260

  Fly   336 TDSEWR-KQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLAN-------PDKHGPNAPASGGG 392
            .|.:.| ..|:|:...:.|::...|.:||.:|:.:|||::.|:.       |..|.....|.||.
  Fly   261 QDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVHETCGVAPGGI 325

  Fly   393 REGVYTKEGGFLAYYEICEMLLNGAVYVWDDEM----KVPYLV-------------DGD--QWVG 438
            :  :.:.| |.|::.|||..|...|...:..|:    ||..|.             :||  .|:.
  Fly   326 Q--IQSAE-GLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWLS 387

  Fly   439 FDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMR 488
            |||......|..:.|..|.||..::.:..|||:| :|.|. |||::.:::
  Fly   388 FDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRG-LCTGQ-KYPILRSIK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 104/410 (25%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 113/431 (26%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 113/432 (26%)
Glyco_18 24..417 CDD:214753 104/409 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.