DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and CG8460

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:405 Identity:87/405 - (21%)
Similarity:147/405 - (36%) Gaps:113/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRIAFVICLLIVL---LSPSADSAQTKTRRRLRRPTTSVSSSRSNLIESKKSTEAPEAEKRIDQ 67
            |||:|.::.||..:   |:|.:..:::||:....|.    .....::.:....:..|.|:    .
  Fly     8 LLRVALLLLLLTTVRGTLAPDSHKSKSKTKESALRG----GPQDQDVFDLGLVSPEPLAK----D 64

  Fly    68 ITSATTTSARRTRLRSKAKLGAAAAGGAAVAAGGTALVASGSSLKGKKTKVDDGTPKIVCYYTNW 132
            |.|......:.|.||               ...||.|                      .|.|.|
  Fly    65 IVSNHRGYFKETGLR---------------RFNGTTL----------------------GYVTPW 92

  Fly   133 SQYRVKIGKFVPE----------------DIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVP 181
            :.:...:.|...:                |..|...||.|.| |||...:....:.:::....| 
  Fly    93 NSHGYDVAKIFAKKFDIISPVWLQIVKQGDRYAVAGTHDIDA-GWLTDVRRKGKQVHNQRTVKV- 155

  Fly   182 GLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMD- 245
              :.|.:.....:..:|:||:              .:...|:...|  .|...:..|||||.:: 
  Fly   156 --FPRFIFDHFTDRDIKLLLS--------------DAQERTKVNDV--LIKCCKDNGFDGLVLEV 202

  Fly   246 WEYPKGS-DDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGP-----DNIRGGYDVPAIA 304
            |....|. |||..:.|:|:        .|:||:|.:|.|...:|  |     .::.|...:..:.
  Fly   203 WSQLAGRIDDKILYTLVLQ--------MAKELQKQQLRLILVIP--PFRKETGHLFGEKHMDKLF 257

  Fly   305 SYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPT 369
            .::...:||.|||..  .:..|.|||||......|   .::.:..|.    |.|.:.|:::|:..
  Fly   258 KHIYAFSLMTYDFSS--VQRPGANAPLYFVRKAVE---TIAPEGCAD----MTAKRAKILLGLNM 313

  Fly   370 YGRSFTLANPDKHGP 384
            ||..:|   ||..||
  Fly   314 YGNDYT---PDGGGP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 66/284 (23%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 66/283 (23%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 69/309 (22%)
Glyco_18 86..393 CDD:214753 67/304 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.