powered by:
Protein Alignment Cht7 and Cda5
DIOPT Version :9
Sequence 1: | NP_647768.3 |
Gene: | Cht7 / 38370 |
FlyBaseID: | FBgn0035398 |
Length: | 1013 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_722590.2 |
Gene: | Cda5 / 33158 |
FlyBaseID: | FBgn0051973 |
Length: | 1998 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 31/72 - (43%) |
Gaps: | 14/72 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 934 SHGPRGAYTTKDPHDVTCAEEDGHISYHKDWADCTHYYMCEGERKHHMPCPANLVFNPQENVCDW 998
|:|| ...|.||.| |:...:|||.||:|.........|...|:::.....|||
Fly 51 SNGP----------SFDCPEEFG---YYPHPSDCTQYYVCVFGGALLESCTGGLMYSHDLQTCDW 102
Fly 999 PENVEGC 1005
|.|| ||
Fly 103 PRNV-GC 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45463852 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.