DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Cda5

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_722590.2 Gene:Cda5 / 33158 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster


Alignment Length:72 Identity:24/72 - (33%)
Similarity:31/72 - (43%) Gaps:14/72 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   934 SHGPRGAYTTKDPHDVTCAEEDGHISYHKDWADCTHYYMCEGERKHHMPCPANLVFNPQENVCDW 998
            |:||          ...|.||.|   |:...:|||.||:|.........|...|:::.....|||
  Fly    51 SNGP----------SFDCPEEFG---YYPHPSDCTQYYVCVFGGALLESCTGGLMYSHDLQTCDW 102

  Fly   999 PENVEGC 1005
            |.|| ||
  Fly   103 PRNV-GC 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884 19/53 (36%)
Cda5NP_722590.2 CBM_14 58..106 CDD:279884 17/50 (34%)
CE4_CDA_like_2 1664..1926 CDD:200597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.