DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Cht11

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:416 Identity:133/416 - (31%)
Similarity:205/416 - (49%) Gaps:70/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GSSLKGKKT-KVDDGTPKIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYE 171
            |..|.|.:| :|.....::||||.:...:.:.:     .|:|.||||||               .
  Fly    51 GLGLLGIQTGEVHKVGQRLVCYYASDGTHNLSL-----LDVPGDLCTHI---------------N 95

  Fly   172 SNDETKDN----VPGLYERMM-----TLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFV 227
            ....|.||    :|....:::     :.:.|:|::.:||.:||...| :.|..|.:....|:.|:
  Fly    96 IGPATLDNATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSG-RSFALMVANHAMRKLFL 159

  Fly   228 YSAIPFLRK-RGFDGLDMDWEYPKGSD-DKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVG 290
            .|....||. ...||:|:|||:|...| ::.:...||.|:|..:..|    |:...:||.|| ..
  Fly   160 RSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRRE----KRTNDILSLAV-AA 219

  Fly   291 PDNIR-GGYDVPAIASYLDFINLMAYDFHGKWERE----TGHNAPLYAPSTDSEWRKQLSVDNAA 350
            |:.|. ..||:..|..|.|::|||:||||  :.||    ||.||||||.|.:.......:::...
  Fly   220 PEGIAFYAYDIREINLYADYVNLMSYDFH--FYREDTPFTGLNAPLYARSQERSLMATFNINYTV 282

  Fly   351 SLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVYTKEGGFLAYYEICEML-- 413
            ..|:|.|...::||:|:||||.||||.||..|...|||||.|:.|    :.||....|.||.:  
  Fly   283 QWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG----QLGFTTLTETCECVTK 343

  Fly   414 -----LNGAVYVWDDEMKVPYLVDGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGE 473
                 |:     :|.|...|||....:|:.::::.:|..|.:::||...||.||::::.||.|..
  Fly   344 FFKPNLS-----YDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS 403

  Fly   474 VCG--GNVKY------PLIGAMREEL 491
             |.  .|:||      ||..|:::.|
  Fly   404 -CSIMPNLKYSEKPVFPLTQAIKDIL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 117/366 (32%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 127/396 (32%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 117/366 (32%)
GH18_chitinase-like 69..428 CDD:299167 127/396 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.