DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and Chil5

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001074285.1 Gene:Chil5 / 229687 MGIID:2676649 Length:431 Species:Mus musculus


Alignment Length:403 Identity:169/403 - (41%)
Similarity:247/403 - (61%) Gaps:21/403 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPGLYERMM 188
            :::|||.|.:|.|.|:|.|.|.||...||||:|:||..::.||::....||.|.      |:.:.
Mouse    23 QLMCYYNNVAQNRPKLGSFNPADIDPCLCTHLIYAFAGMQNNKVTMRSMNDLTD------YQALN 81

  Fly   189 TLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYP--KG 251
            |||..|.:||.|||:||..||...|..|.||.:.:|||:.|||.|||:.|||||::||::|  :|
Mouse    82 TLKSRNVQLKTLLAIGGRDFGPAPFSAMVSTPHNQQTFINSAIKFLRQYGFDGLNLDWQFPGSRG 146

  Fly   252 SD--DKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMA 314
            |.  ||..|.:|::::|||||.||.|.|.|||:::|.|......|:.||::|.::.:||:|.:|.
Mouse   147 SPSRDKHLFTVLVQKIREAFELEAIENKSPRLMVTATVAGVISTIQSGYEIPQLSHFLDYIQVMT 211

  Fly   315 YDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFTLANP 379
            |:.||..:..||.|:|||....|:.....|:||...:.|.:.||..|||::|.|.||::|||::|
Mouse   212 YNLHGSQDGYTGENSPLYKSLNDTGINTLLNVDYIMTYWNENGAAPEKLIVGFPAYGQTFTLSDP 276

  Fly   380 DKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDEMKVPYLVDGDQWVGFDDERA 444
            ..:|.:||.:..|..|.||:|.|..||||||..|.:||...||...:|||...|::|||:|:.::
Mouse   277 SNNGISAPTASAGTLGPYTEESGTWAYYEICSFLNDGATEAWDSAQEVPYAYQGNKWVGYDNVKS 341

  Fly   445 IRNKMHWIKSNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMREELLGISRGKEAKDVNWTAVA 509
            .|.|..|:|.|..||||:||:|||||.|..|... ::||...::..||..|          |:..
Mouse   342 FRIKAEWLKQNNLGGAMLWTLDMDDFTGSFCNQG-QFPLTSTLKNALLVYS----------TSCM 395

  Fly   510 ATFEDIEEKPEPI 522
            |:..|:::...|:
Mouse   396 ASVSDLQQVNAPL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 154/347 (44%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 162/369 (44%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
Chil5NP_001074285.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 162/369 (44%)
Glyco_18 26..365 CDD:214753 154/344 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846862
Domainoid 1 1.000 365 1.000 Domainoid score I929
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm8820
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.