DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-12

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_506770.2 Gene:chil-12 / 187357 WormBaseID:WBGene00010799 Length:450 Species:Caenorhabditis elegans


Alignment Length:393 Identity:99/393 - (25%)
Similarity:166/393 - (42%) Gaps:78/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SSLKGK----KTKVDDGTPKIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLK------ 163
            :|.|.|    ||:.:..:.:|:.||:..|...:.|.:       ....||.||||..|.      
 Worm    75 NSFKNKFPPIKTEENTCSKRIIGYYSGTSDSEITINQ-------VSKLTHAIFAFVQLTFDGTLV 132

  Fly   164 -KNKLSSYESNDETKDNVPGLYERMMTL----KKANPKLKILLALGGWSFGTQKFKDMSSTRYTR 223
             :||                  .|.|.|    |..|..:|.:.::||... :|.|..:...:..:
 Worm   133 FRNK------------------NRFMALRNIAKTENSTVKFMFSIGGPGH-SQNFSPVVRNQEKK 178

  Fly   224 QTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPR--LLLSAA 286
            :.|:.|...||.:...||:|:.|::|..:|         |.....|..|..|:.|.|  .:||..
 Worm   179 RRFIKSIFSFLEEHKLDGVDIFWKWPHLAD---------KHAYSQFLLELNEILKTRKDYILSIL 234

  Fly   287 VPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGKWE----RETGHNAPLYAPSTDSEWRKQLSVD 347
            ||........|:.:..|...:||||:.|.|::|.|.    ..||..:|:|.   .||.|:|.:||
 Worm   235 VPPQGIGFASGFKMNEIVENVDFINIFAMDYYGPWASGWGNPTGPISPIYG---GSERREQWNVD 296

  Fly   348 NAASLWVKMGAPKEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGREGVYT-------KEGG--F 403
            |.|:::........|..|.:|.:.|.:.  |..|     |....|:| ||.       |..|  :
 Worm   297 NTAAIYSCETMRSSKFNIVIPFFARLWN--NVGK-----PIDFPGKE-VYRNVTLIDGKAVGEVY 353

  Fly   404 LAYYEICEMLLNGAVYVWDDEMKVPYLVDG--DQWVGFDDERAIRNKMHWIKSNGFGGAMVWTID 466
            :......:...|.:.|.:||..:..::.:.  .:::.|:.:|:|..|:.::::...||..:|.:|
 Worm   354 MPRRSALQKGYNLSSYNYDDLSETAFIYNSTTKEYLTFEVKRSIAAKLDYVQNMNLGGVWIWQMD 418

  Fly   467 MDD 469
            |||
 Worm   419 MDD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 91/371 (25%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 94/373 (25%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-12NP_506770.2 Glyco_18 94..420 CDD:214753 91/371 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.