DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-7

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:395 Identity:90/395 - (22%)
Similarity:170/395 - (43%) Gaps:72/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVCYYTNWSQYRV------KIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVPG 182
            :||.|||:|...::      |:...:..::|.:...|:.|                       ..
 Worm   127 RIVGYYTDWEPRKISAKQLQKLTHLIFTNVPMNSSGHVFF-----------------------EN 168

  Fly   183 LYERMMTL---KKAN-PKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLD 243
            |.:|...|   :||. ..:|::.::||.. ..:.:..:.:....|..|:.|.:.|::.....|:|
 Worm   169 LAQRRRFLEINRKAQLMNVKVMFSIGGHK-NAEHYSTVVADSTKRSVFIDSIVSFIKSNNASGVD 232

  Fly   244 MDWEYPKGSDDKKNFVLLLKELREAFEA--EAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASY 306
            :.||:|..| :..:|:..:||||:...|  :||. |..|.|||..||..|.::.....:..:..|
 Worm   233 LFWEWPNIS-EMNDFITTIKELRKKLAALTKAQP-KGTRYLLSIIVPSSPSDLEYYLRMDGLLHY 295

  Fly   307 LDFINLMAYDFHGKWE----RETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGM 367
            :||:|::.|.::..|.    :..|.|||||..:.:       :||......:.......||.:.:
 Worm   296 VDFLNVLTYGYYAPWSGVNGKFVGPNAPLYGGNRE-------NVDETMQYLICKTRTPSKLNMAL 353

  Fly   368 PTYGRSFTLAN---PDKHGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDEMKVPY 429
            ..|||.:...|   ||:....|....|..:|:      |:|:..:.....:.:..:|.:|.::||
 Worm   354 SFYGRYWENVNDNVPDEMFKEADLINGKAQGM------FVAWKNLAGRGWDKSEALWHEETQIPY 412

  Fly   430 LVDGDQ--WVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDD---------FKGEVC---GGNVK 480
            :.:.::  :..|::||:::.||.:...:..||..:|.:..||         ...::|   .||..
 Worm   413 IWNSEERKFFVFENERSLQAKMDYAADHNIGGVYIWALGADDNNDTLLNVVSSADLCEGGSGNTL 477

  Fly   481 YPLIG 485
            ..|.|
 Worm   478 ISLCG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 83/364 (23%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 90/394 (23%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 83/364 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.