DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-2

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:370 Identity:83/370 - (22%)
Similarity:156/370 - (42%) Gaps:100/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 THIIFAF------GWLKKNKLSSYESNDETKDNVPGLYERMMTLKKANPKLKILLALGGWSFGTQ 211
            ||.||..      |.:|.....::||           |.|  ..|..||.|||::.:.|      
 Worm    60 THFIFTSISIFPNGTIKWPNCENFES-----------YAR--KAKMDNPNLKIMVEING------ 105

  Fly   212 KFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQEL 276
            ||..:.:....:.:|:.|...|:....|||:|:.|.:|   :|:..|.|.:||.||..|      
 Worm   106 KFFSVLAEDEKKNSFIKSISSFVVDHKFDGVDIFWSWP---EDEDTFHLFIKEFREKLE------ 161

  Fly   277 KKPRLLLSAAVPVGPDNIRGGYDVPAIASYLDFINLMAYDFHGKWERETGHNA------PLYAPS 335
              ..:::|.|:|.....:. |:::..:.:::||:|:::.::   :|...|:.|      |||.  
 Worm   162 --KHMIISIAIPRLAQQLE-GFNLKLLMNHIDFLNVLSINY---YEPLPGNGANIGPISPLYG-- 218

  Fly   336 TDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPTYGRSFT--LANPDKHG-------------PN 385
                 .::.:||  .:|.......|...::.|   |.:||  ..|..|.|             .|
 Worm   219 -----GQRGNVD--GTLKYLTCITKRPSILNM---GVTFTGIFWNGVKDGLNEQDDIWKVAQNEN 273

  Fly   386 APA-SGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDEMKVPYLVDGDQWVGFDDERAIRNKM 449
            .|. |.|.|:.:..:......:::..:     :.|.||.:.|:        ::.|::|:::..|:
 Worm   274 GPGKSIGWRKFIKDRRNTIPQWHDSSK-----SSYAWDPKSKI--------FLAFENEKSLSEKV 325

  Fly   450 HWIKSNGFGGAMVWTIDMDDFKG---------EVC----GGNVKY 481
            .::::...||.::|.:|.||...         ::|    ||.:||
 Worm   326 IYVRNKNIGGLVIWNVDQDDNDNSLLNALTSMDMCARGSGGTMKY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 76/342 (22%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 83/370 (22%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 76/342 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.