DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-8

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001379090.1 Gene:chil-8 / 174541 WormBaseID:WBGene00007473 Length:399 Species:Caenorhabditis elegans


Alignment Length:397 Identity:86/397 - (21%)
Similarity:173/397 - (43%) Gaps:69/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IVCYYTNWSQ--------YRVKIGKFVPEDIPADL-------CTHIIFAFGWLKKNKLSSYESND 174
            :.||:.::|.        :|.:|..:|..|..:::       .||:||||..:.|:....::.. 
 Worm    28 LFCYFYDFSNSVQSPSVLHRKRIIGYVSSDEGSEITIKQLEKLTHVIFAFILVHKDGTIKFKYG- 91

  Fly   175 ETKDNVPGLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGF 239
             |||   |.::......:.|..||:::::||:. .:..|.|:...:  ::..:.|....::|...
 Worm    92 -TKD---GFFDMKRKSMELNRGLKVMVSIGGYE-SSPLFSDVLVKK--KKKLIASIALLVKKFDL 149

  Fly   240 DGLDMDWEYPKGSDDKKNFVLLLKELREAF-EAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAI 303
            ||:|:.|.:| ...|:.|:::.::|||:.. ..:.:..:....::|...|....:....|....|
 Worm   150 DGVDIFWNWP-SITDQSNYLIFIRELRKKLTNLKDENGRSNEYVISVIAPSSSSHSEYPYKWTEI 213

  Fly   304 ASYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAAS-LWVKMGAP-KEKLVIG 366
            ...:||||::.:::..: ..:.|.::|||..|..       :||:... |..:...| |..:|:.
 Worm   214 LENVDFINVITFEYFYE-ANKIGPHSPLYGGSFG-------NVDDTLKYLICRTRTPNKLNMVVS 270

  Fly   367 M-PTYGRSFTLANPDK------HGPNAPASGGGREGVYTKEGGFLAYYEICEMLLNGAVYVWDDE 424
            . ..|..:.||...||      .....|.|.|.::......|            .:...:.|::|
 Worm   271 FNGIYWGNTTLPFDDKGVWIPDDSAQGPYSYGWKQFARMSHG------------FDQNDFEWNEE 323

  Fly   425 MKVPYL--VDGDQWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDDFKGEV------------- 474
            .:.||:  .|..|::.|::|:::..||::..::..||..::|||.||.:..:             
 Worm   324 TRTPYIWKADTQQFLTFENEKSLTEKMNYAVAHNIGGVAMYTIDDDDEENTLLNVVVTNLPSLKK 388

  Fly   475 CGGNVKY 481
            .||..||
 Worm   389 SGGETKY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 80/369 (22%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 86/397 (22%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-8NP_001379090.1 Glyco_18 49..369 CDD:214753 76/348 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.