DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-13

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_496018.2 Gene:chil-13 / 174500 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans


Alignment Length:377 Identity:92/377 - (24%)
Similarity:173/377 - (45%) Gaps:55/377 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 NAVASNTRPAQVFCYLTSWSAKRPGAGKF--------QPENIDPKLCTHIVYAFATLQDYKLTEA 605
            |.|.:|..|.:..|       ||...|.|        ....|| || ||.|:||..:: |..|..
 Worm    65 NLVLNNESPKKPVC-------KRRIVGYFSEIESTEISKSQID-KL-THAVFAFVRIK-YDGTLQ 119

  Fly   606 TDDDPENYE-SVIALRDNNPDLQILLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFN 669
            .|:...:.. |::..:....:::::::|||....:..|....|:..:...|:...:.||.:::.:
 Worm   120 FDNSKADLRFSILKDKTRGSNVEMMVSIGGGYENAHYFASALSDSQKKKNFIDSILAFLVEHRID 184

  Fly   670 GLDVDWEYPRGAEDRVAYVSLLKELRVAFEGEAKSSGLPRLLLTAAVPAS-FEAIAAGYDVPEIS 733
            |:|..|::|. .:|...||:.::|||...:...:.    ..|::..|||: .:....|:|:.|:.
 Worm   185 GVDFFWQWPT-VQDTFNYVTFIRELRQKLDENKRK----HFLISMTVPAAGVDNWELGFDLEELQ 244

  Fly   734 KYLDFINVMTYDFHG----QWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLI 794
            .::||.||.:.|:.|    ||....|.:||:|   ...|.:|...||::.:.:..:......|.:
 Worm   245 NHVDFFNVYSMDYAGPWPNQWGVPTGPSSPMF---YNIGARKNFYVDWTMKHYTCKLKQPSMLNM 306

  Fly   795 GMPTYGRSFELVN---DTQFDI-------GSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNTTL 849
            .:|...|.:..|.   |.:.::       .:.:.|..:..::|.|...|.       |:..:   
 Worm   307 VIPFSARIWNNVQEAIDNRTEVFRNAELKNNMAEGRTQISRWTAEHEGLE-------LSPSS--- 361

  Fly   850 VWDSEQQVPFA--YRGNQWVGFDDERSLKTKTEWLKEQGFGGIMVWSIDMDD 899
             ||:....|:.  .:...::.|:|:||:|.||::.|:...||:.:||:||||
 Worm   362 -WDNLTMTPYILDLKAKTFLTFEDKRSIKIKTDYAKKMDLGGVWLWSVDMDD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 85/364 (23%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 88/366 (24%)
CBM_14 951..1005 CDD:279884
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 82/351 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.