DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and chil-24

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_494455.1 Gene:chil-24 / 173661 WormBaseID:WBGene00020407 Length:410 Species:Caenorhabditis elegans


Alignment Length:406 Identity:101/406 - (24%)
Similarity:188/406 - (46%) Gaps:71/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SSLKGKKTKVDDGTPKIVCYYTNWSQYRV---KIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSY 170
            |:.|....:.:....:||.:|.:|.:..:   ::.|.          ||.:||:..:|.:....:
 Worm    40 SNYKMSNNETETTPSRIVGFYADWERTDITSHQVAKL----------THAVFAYVQMKFDGSLGF 94

  Fly   171 ESNDETKDNVPGLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLR 235
            : ||..:.....|.:::...:.:|  :|:::::||:. .:|.|..:.|....::.|:.|...||.
 Worm    95 K-NDAARIRFSNLRDKVRRNEDSN--VKMMISIGGFE-NSQHFYPVLSNVEMKKAFLNSISSFLA 155

  Fly   236 KRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGP-DNIRGGYD 299
            .....|:|:.|::| ..:||.::...|.:||:....|        .::|.|||... .|:..|||
 Worm   156 YHELHGVDIFWKWP-SPEDKAHYSRFLADLRQHLGYE--------FIISVAVPQAEVSNLELGYD 211

  Fly   300 VPAIASYLDFINLMAYDFHGKWERE----TGHNAPLYAPSTDS-EWRKQLSVDNAASLWVKMGAP 359
            :..|:|::||.|:.:.|::|.|..|    ||..:|||.|:..: :|..:...:       |.|.|
 Worm   212 LRTISSHVDFFNVHSMDYYGPWPNEWGKPTGPISPLYGPTRHNVDWTLRYYAE-------KTGEP 269

  Fly   360 KEKLVIGMPTYGRSFTLANPDKHGPNAPASGGGR-----EGVYTKEGG------FLAYYEICEML 413
             .||.:.:|.:.|.:      |:.|. |...|.:     |.|..|..|      :.|.:|  |:.
 Worm   270 -GKLNMVIPFFVRLW------KNVPE-PVEPGRQVFRDVELVDNKPQGEAYMSRWSAQHE--ELD 324

  Fly   414 LNGAVYVWDDEMKVPYLVDGD--QWVGFDDERAIRNKMHWIKSNGFGGAMVWTIDMDD------- 469
            |:.|  .||:|.:..|..:.|  .:|.|:.:::|:.||.::|....||..:|.:|.::       
 Worm   325 LSPA--DWDEETRSSYTWNPDTRNFVTFETDKSIQEKMKYVKEKNLGGVWIWHVDANEKLLDSVR 387

  Fly   470 FKGEVCGGNVKYPLIG 485
            |.||....:.:|..||
 Worm   388 FDGEGVVDDQEYREIG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 93/365 (25%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 99/390 (25%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
chil-24NP_494455.1 Glyco_18 55..378 CDD:214753 92/364 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.