DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and T19H5.6

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:228 Identity:54/228 - (23%)
Similarity:112/228 - (49%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VDDGTP-----KIVCYYTNWSQYRVKIGKFVPEDIPADLCTHIIFAFGWLKKNKLSSYESNDETK 177
            |::..|     :::.||....:.::.|     |:: ::| ||.:|||.::..:....: ||...:
 Worm    58 VEENAPTVCEKRVIGYYAGTEKSQITI-----EEV-SEL-THAVFAFVYMATDGTLMF-SNQAQR 114

  Fly   178 DNVPGLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGL 242
            :....|.|   ..|..|..:|::.::|| ...:|.|..::::...:::|:.:.:..|.|...||:
 Worm   115 NRFLKLKE---LTKNENSTVKMMFSIGG-KDNSQNFSPVTASPDRKKSFINAILELLEKYDLDGV 175

  Fly   243 DMDWEYPKGSDDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGPDNIRGGYDVPAIASYL 307
            |:.|.:|| ||||..:.:.|:||::..:|.    :|..:|.....|:..:.....:|:..|..:.
 Worm   176 DLFWRWPK-SDDKDEYAVFLRELKKQLKAR----RKDYILSVVVAPLDINRWDSKFDIKKIIKHA 235

  Fly   308 DFINLMAYDFHGKWERETGHNAPLYAPSTDSEW 340
            |||::     :|..:..|...:|::|    |.|
 Worm   236 DFISI-----YGLAKNTTDSESPMFA----SAW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753 52/217 (24%)
GH18_chitolectin_chitotriosidase 125..491 CDD:119351 52/216 (24%)
Glyco_18 559..898 CDD:214753
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:279884
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 49/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.