DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and LOC1280544

DIOPT Version :10

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:XP_320394.5 Gene:LOC1280544 / 1280544 VectorBaseID:AGAMI1_006280 Length:327 Species:Anopheles gambiae


Alignment Length:44 Identity:20/44 - (45%)
Similarity:24/44 - (54%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 DCTHYYMCEGERKHHMPCPANLVFNPQENVCDWPENVEGCHTPT 1009
            :|..:|.|.|.....|.||..|.|||::|.|||||  ..|..||
Mosquito   128 NCAKFYKCSGPFACPMDCPPLLHFNPKQNACDWPE--RACCDPT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:426342 17/38 (45%)
LOC1280544XP_320394.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.