DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and LOC1270270

DIOPT Version :10

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:XP_308952.4 Gene:LOC1270270 / 1270270 VectorBaseID:AGAMI1_009230 Length:201 Species:Anopheles gambiae


Alignment Length:116 Identity:33/116 - (28%)
Similarity:44/116 - (37%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 DMDDFSGRCGSG-----KYPLLTALNDELKDYKVELEYDGPYESHGPRGAYTTKDP---HDVTCA 952
            |.|.|. .|..|     |.|.....||..|      :.|.|.::....|.....:|   ....|.
Mosquito    87 DCDKFL-ICNHGTTVVSKCPPGLLWNDSQK------QCDYPAQAQCAPGVTPNTEPAPKPSPNCP 144

  Fly   953 EE--DGHISYHKDWADCTHYYMCEGER-KHHMPCPANLVFNPQENVCDWPE 1000
            .|  ..|:.|.....||..||:|:... :....||:.|.:||..|.||:||
Mosquito   145 PEYDPDHMVYIPHETDCGKYYICDPYGVELEQTCPSGLHWNPVVNYCDFPE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 9/27 (33%)
CBM_14 951..1005 CDD:426342 19/53 (36%)
LOC1270270XP_308952.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.