DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht7 and LOC100494478

DIOPT Version :9

Sequence 1:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster
Sequence 2:XP_002931718.1 Gene:LOC100494478 / 100494478 -ID:- Length:361 Species:Xenopus tropicalis


Alignment Length:347 Identity:85/347 - (24%)
Similarity:145/347 - (41%) Gaps:60/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 IDPKLCTHI-------VYAFATLQD----YKLTEATDDDPENYESVIALRDNNPDLQILLAIGGW 635
            :||.||..:       |:.|...:.    |..|:.|        :|....:..|||.......|.
 Frog    30 LDPALCEPVAETRDFEVFVFHVREKNWLLYDWTQIT--------TVATFAEYEPDLMCFAHSKGV 86

  Fly   636 AF---GSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYP--RGAEDRVAYVSLLKELR 695
            .:   |....|::.....| ..::.|.::..:....:|.::|.|.|  :|:.:..|..:|::|..
 Frog    87 RYVLSGDVSLKDIVDPKIR-TAWITEKLELAQSQFMDGFNLDIEQPVLKGSPEYYALTALVQETT 150

  Fly   696 VAFEGEAKSSGLPRLLLTAAVPASFEAIAAG-YDVPEISKYLDFINVMTYDFHGQ--WERTVGHN 757
            .||..|     :|...:|..||.:...:||. |:...|:...||:.||:||...|  .|...|.|
 Frog   151 EAFHRE-----IPGSQVTFDVPWAPNCVAARCYNYTGIADLCDFLFVMSYDMPPQLFTEWVAGAN 210

  Fly   758 SPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFE---LVNDTQFDIGSPSSG 819
            ||.  .|:.|||.          :::..|...:||::|:|.||..:|   |..|.:..:      
 Frog   211 SPY--NETLTGYD----------QFINLGINPKKLVMGIPWYGYDYECLKLTKDNKCIL------ 257

  Fly   820 GGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPF----AYRGN-QWVGFDDERSLKTKT 879
             .|.....:.|..:.|..:...|.:..:..:||..|:.||    ..:|| ..|.:||..|:..|.
 Frog   258 -FKESLLDSAAQQVPYSTIMKQLNSSLSGRLWDDFQKSPFFNYLDTQGNIHQVWYDDPESISLKA 321

  Fly   880 EWLKEQGFGGIMVWSIDMDDFS 901
            .::.::...||.:|:.|..|:|
 Frog   322 AYVPKRSLRGIGMWNADTLDYS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht7NP_647768.3 Glyco_18 124..468 CDD:214753
GH18_chitolectin_chitotriosidase 125..491 CDD:119351
Glyco_18 559..898 CDD:214753 83/342 (24%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 85/347 (24%)
CBM_14 951..1005 CDD:279884
LOC100494478XP_002931718.1 GH18_chitobiase 10..359 CDD:119354 85/347 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.