DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN3 and AT4G19110

DIOPT Version :9

Sequence 1:NP_647767.1 Gene:PAN3 / 38369 FlyBaseID:FBgn0035397 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_849407.1 Gene:AT4G19110 / 827649 AraportID:AT4G19110 Length:464 Species:Arabidopsis thaliana


Alignment Length:275 Identity:51/275 - (18%)
Similarity:103/275 - (37%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 TFPATTYRATHNTTGYKYCLRRIHGFRLQSTKCMTL--VEMWKKLQHTNVVQLREVFTTKAFGDN 465
            || .:.:||.:..||....::::........:|:.|  |:..:::.|.|:|:|:||...    ::
plant    14 TF-GSVWRAINKQTGEVVAIKKMKKKYYSWDECINLREVKSLRRMNHPNIVKLKEVIRE----ND 73

  Fly   466 SLVLVYDYHPGSQTLLAKYFTPAPETNGYTDPFQGEARPFSHKSNMQRTSNGPLLPEATIWSIIM 530
            .|..|::|.                          |...:....:.|:     |..||.|.:...
plant    74 ILYFVFEYM--------------------------ECNLYQLMKDRQK-----LFAEADIKNWCF 107

  Fly   531 QLTAGLKAIHHAGLACKVLDPTKIIVTGKRVRFSSCCISDITQFDPNASN---------PLALVN 586
            |:..||..:|..|...:.|.|..::|:...::.:...::......|..:.         |..|:.
plant   108 QVFQGLSYMHQRGYFHRDLKPENLLVSKDIIKIADFGLAREVNSSPPFTEYVSTRWYRAPEVLLQ 172

  Fly   587 MH---QQDDLTALGRLVLALACRCLQSV-----QRDNVQSSIDMV-TRNYST-----DLRNFIVY 637
            .:   .:.|:.|:|.::..|.  .|:.:     :.|.:.....:: |....|     :|.|.|.|
plant   173 SYVYTSKVDMWAMGAIMAELL--SLRPIFPGASEADEIYKICSVIGTPTEETWLEGLNLANTINY 235

  Fly   638 LFTTNNRRSVTDLMP 652
            .|.......::.|||
plant   236 QFPQLPGVPLSSLMP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN3NP_647767.1 DUF4797 245..284 CDD:292670
PKc 406..>570 CDD:270622 30/165 (18%)
AT4G19110NP_849407.1 STKc_MAK_like 4..283 CDD:270824 51/275 (19%)
S_TKc 4..283 CDD:214567 51/275 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.