DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN3 and LOC690235

DIOPT Version :9

Sequence 1:NP_647767.1 Gene:PAN3 / 38369 FlyBaseID:FBgn0035397 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_038938164.1 Gene:LOC690235 / 690235 RGDID:1582875 Length:502 Species:Rattus norvegicus


Alignment Length:315 Identity:59/315 - (18%)
Similarity:106/315 - (33%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 AEAAQHALPLE----VENYHALYPLEPPAQPLHAKLTFPATTYRATHNTTG----YKYCLRRIHG 427
            :|.....||.|    .|::|:.|.:.....  |...   ||...|.|..||    .|..:::.|.
  Rat     5 SEQESERLPSEGSSYTESFHSQYMILNTIG--HGGY---ATVKLALHRLTGTPVAVKILIKKEHW 64

  Fly   428 FRLQSTKCMTLVEMWKKLQHTNVVQLREVFTTKAFGDNSLVLVYDYHPGSQTLLAKYFTPAPETN 492
            ....:::    |::...:.|.|::.|.:|..||    ..:.|:.:...|.|.             
  Rat    65 CHPVTSE----VDIMMSIHHPNIISLFQVIETK----KKIYLIMELAEGKQL------------- 108

  Fly   493 GYTDPFQGEARPFSHKSNMQRTSNGPLLPEATIWSIIMQLTAGLKAIHHAGLACKVLDPTKIIV- 556
                              ..|......|.|.....|..||.:.....|..|:..:.|.|..|:: 
  Rat   109 ------------------YHRIREAGQLQEDEARGIFRQLLSATGYCHARGIVHRDLKPDNIMID 155

  Fly   557 TGKRVRFSSCCISDITQFDPN------------ASNPLALVNMHQ--QDDLTALGRLVLALACRC 607
            |..|::.....::  |...|.            |:..:.|..:::  :.|:..||   :.|.|..
  Rat   156 TRGRIKIIDFGLA--THVRPGQKLRYHCGTYAFAAPEMLLGKLYEGPKVDVWTLG---VVLYCMT 215

  Fly   608 LQSVQ---------RDNVQSSIDMVTRNYSTDLRNFIVYLFTTN--NRRSVTDLM 651
            :..:.         |..|.|....|....|.:|::.:..|...|  :|.::.||:
  Rat   216 VGRLPFDDSNIPQLRSQVVSGKYAVPPGMSGELKDMLSLLLKVNPQHRPTIPDLL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN3NP_647767.1 DUF4797 245..284 CDD:292670
PKc 406..>570 CDD:270622 31/168 (18%)
LOC690235XP_038938164.1 STKc_AMPK-like 26..274 CDD:270905 53/294 (18%)
UBA_MARK_Par1 294..333 CDD:270522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.