DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN3 and prkci

DIOPT Version :9

Sequence 1:NP_647767.1 Gene:PAN3 / 38369 FlyBaseID:FBgn0035397 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_571930.2 Gene:prkci / 117507 ZFINID:ZDB-GENE-011105-1 Length:588 Species:Danio rerio


Alignment Length:378 Identity:70/378 - (18%)
Similarity:130/378 - (34%) Gaps:150/378 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 VYDYHPGSQTLLAKYFTPAPETNGYTDPFQGE------------------------ARPFSHKSN 510
            :|:.:..|: |:...|...||..|.  |..||                        |:.|:.:::
Zfish    85 LYELNKDSE-LIIHVFPCVPEKPGM--PCPGEDKSIYRRGARRWRKLYYATGHAFQAKRFNRRAH 146

  Fly   511 MQRTSNGPLLPEATIWSIIMQLTAGLKAIHHAGLACKVLDPTKI--IVT---GKRVRFSSCCISD 570
            ....::       .||.:..|   |.|.|:     ||:|...|.  :||   |::|      |.|
Zfish   147 CAICTD-------RIWGLGRQ---GYKCIN-----CKLLVHKKCHKLVTVECGRQV------IQD 190

  Fly   571 --ITQFDPNASNP------LALVNM-----HQQDDLTALGRLVLALACRCLQSVQRDNVQSSIDM 622
              |.:.||.:::|      |...|.     |:.::..|:|            |.:.....||:.:
Zfish   191 PMIGRIDPGSTHPEHPDQVLGKKNSTESINHEGEEHEAVG------------SRESGKAVSSLGL 243

  Fly   623 VTRNYSTDLRNFIVYLFTTNNRRSVTDLMPMIGARFYTQLDALQSKIDMQEDELAKEMENGRLYR 687
            :         :|              ||:.:||...|.::..::.|            :..|:|.
Zfish   244 I---------DF--------------DLLRVIGRGSYAKVLLVRLK------------KTERIYA 273

  Fly   688 I-LVKLNSINERPDFNLDCTWSETGDRYML--------------------KLF--------RDYL 723
            : :||...:|:..|.:    |.:| ::::.                    :||        .|.:
Zfish   274 MKVVKKELVNDDEDID----WVQT-EKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLM 333

  Fly   724 FHSVTEDGRPWLDHAHIVQCLNKLDAGSIERVQLMSRDEQ--SVLIVSYAELK 774
            ||...:...| .:||........|....:....::.||.:  :||:.|...:|
Zfish   334 FHMQRQRKLP-EEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN3NP_647767.1 DUF4797 245..284 CDD:292670
PKc 406..>570 CDD:270622 27/128 (21%)
prkciNP_571930.2 PB1_aPKC 19..101 CDD:99725 4/16 (25%)
C1_1 134..184 CDD:278556 14/64 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..213 4/18 (22%)
STKc_aPKC_iota 225..588 CDD:270769 35/214 (16%)
S_TKc 246..514 CDD:214567 30/172 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.