DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN3 and NEK6

DIOPT Version :9

Sequence 1:NP_647767.1 Gene:PAN3 / 38369 FlyBaseID:FBgn0035397 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001138473.1 Gene:NEK6 / 10783 HGNCID:7749 Length:347 Species:Homo sapiens


Alignment Length:406 Identity:78/406 - (19%)
Similarity:131/406 - (32%) Gaps:150/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 PALHGVSAVAPMSAGVPAAMMYTGHVYPGPSSNVVTMQPKTLLESAFFMPDEMRAEVLARNEISN 365
            |.:..:..:|...||.|      ||:..|.|||                               |
Human    23 PRVRALVRLACRMAGQP------GHMPHGGSSN-------------------------------N 50

  Fly   366 LIMDAAEAAQHALPLEVENYHALYPLEPPAQPLHAK-LTFPAT-----------------TYRAT 412
            |.                  |.|.|:.||....|.. |:|..:                 .|:||
Human    51 LC------------------HTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKAT 97

  Fly   413 HNTTGYKYCLRRIHGFRLQSTK----CMTLVEMWKKLQHTNVVQLREVFTTKAFGDNSLVLVYDY 473
            .........|:::..|.:...|    |:..:.:.|:|.|.|:::..:.|    ..||.|.:|.:.
Human    98 CLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSF----IEDNELNIVLEL 158

  Fly   474 -HPGSQTLLAKYFTPAPETNGYTDPFQGEARPFSHKSNMQRTSNGPLLPEATIWSIIMQLTAGLK 537
             ..|..:.:.|||                       ...:|     |:||.|:|...:||.:.::
Human   159 ADAGDLSQMIKYF-----------------------KKQKR-----LIPERTVWKYFVQLCSAVE 195

  Fly   538 AIHHAGLACKVLDPTKIIVTGKRV---------RFSSCCISDITQFDPNASNP--LALVNMHQ-- 589
            .:|...:..:.:.|..:.:|...|         ||.|   |:.|........|  ::...:|:  
Human   196 HMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFS---SETTAAHSLVGTPYYMSPERIHENG 257

  Fly   590 ---QDDLTALGRLVLALACRCLQSVQRDNVQSSIDMVTRNYSTDLRNFIVYLFTTNNRRSVTDLM 651
               :.|:.:||.|:..:|  .|||               .:..|..|    ||:...:....|..
Human   258 YNFKSDIWSLGCLLYEMA--ALQS---------------PFYGDKMN----LFSLCQKIEQCDYP 301

  Fly   652 PMIGARFYTQLDALQS 667
            |:.|..:..:|..|.|
Human   302 PLPGEHYSEKLRELVS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN3NP_647767.1 DUF4797 245..284 CDD:292670
PKc 406..>570 CDD:270622 35/194 (18%)
NEK6NP_001138473.1 STKc_Nek6 76..343 CDD:270865 57/298 (19%)
S_TKc 79..344 CDD:214567 57/295 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.