DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and TRAF4

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_011523806.1 Gene:TRAF4 / 9618 HGNCID:12034 Length:477 Species:Homo sapiens


Alignment Length:182 Identity:40/182 - (21%)
Similarity:62/182 - (34%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GMHEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEIS 162
            |...|...:....|.|.:|....:..:.....||..|..|....|::|     :..||..::.:.
Human     3 GFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEG-----VFKCPEDQLPLD 62

  Fly   163 KSTASR-------NLAVEKAASELP-----------------------SECQF----CNKEFPYK 193
            .:....       :..:|.....||                       :.|.|    |....|.|
Human    63 YAKFPHPYPQIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMK 127

  Fly   194 ----SLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKSGY 241
                .|..|.||:|.:|..||::  .||.:.|..:|:  ||..|  ||:|.|
Human   128 LSRRDLPAHLQHDCPKRRLKCEF--CGCDFSGEAYES--HEGMC--PQESVY 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 11/54 (20%)
Sina 168..>232 CDD:302762 22/101 (22%)
TRAF4XP_011523806.1 RING 18..55 CDD:238093 8/41 (20%)
zf-TRAF 109..163 CDD:280357 17/57 (30%)
zf-TRAF 217..276 CDD:280357
MATH_TRAF4 315..470 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.