DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and AT5G53360

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001330825.1 Gene:AT5G53360 / 835417 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana


Alignment Length:111 Identity:27/111 - (24%)
Similarity:38/111 - (34%) Gaps:46/111 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LAVEKAASELPSECQF----CNKEFPYKSLERHEQHECQERPTKCKY------------------ 212
            :|:||.|..|...|::    |...|||.|..:||. :|..||..|.|                  
plant    15 IALEKVAESLELPCKYYNLGCLGIFPYYSKLKHES-QCNFRPYSCPYAGSECAAVGDITFLVAHL 78

  Fly   213 ---HRI----GCQWRGPYHETNEHERN----------------CLH 235
               |::    ||.:...|.::|..|..                |||
plant    79 RDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTVFQCFGQYFCLH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631
Sina 168..>232 CDD:302762 24/90 (27%)
AT5G53360NP_001330825.1 Sina 15..211 CDD:397316 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.