DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and AT3G61790

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_567118.1 Gene:AT3G61790 / 825352 AraportID:AT3G61790 Length:326 Species:Arabidopsis thaliana


Alignment Length:244 Identity:62/244 - (25%)
Similarity:90/244 - (36%) Gaps:90/244 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AAASGM-------HEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQI 151
            |||||:       ||.|.        |.||.:.....::||..||.:|:.|      ..|:.:: 
plant    45 AAASGLLPTTTSVHELLE--------CPVCTNSMYPPIHQCHNGHTLCSTC------KARVHNR- 94

  Fly   152 ATCPNCRVEISKSTASRNLAVEKAASELPSECQF----CNKEFPYKSLERHEQHECQERPTKCKY 212
              ||.||.|:..   .|.||:||.|..|...|:.    |.:.|||.|..:||. .|..||..|.|
plant    95 --CPTCRQELGD---IRCLALEKVAESLELPCKHMSLGCPEIFPYYSKLKHET-VCNFRPYSCPY 153

  Fly   213 ---------------------HRI----GCQWRGPYHETNEHERN----------------CLHP 236
                                 |::    ||.:...|.::|..|..                ||| 
plant   154 AGSECSVTGDIPFLVAHLRDDHKVDMHSGCTFNHRYVKSNPREVENATWMLTVFHCFGQYFCLH- 217

  Fly   237 QKSGYEV---------MAALEAHDDRIKEEKKMFNTLIDLLSY-EKIIF 275
                :|.         ||.|....|  :.|.:.:|..:::..| .|:|:
plant   218 ----FEAFQLGMAPVYMAFLRFMGD--ETEARNYNYSLEVGGYGRKLIW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 15/54 (28%)
Sina 168..>232 CDD:302762 26/92 (28%)
AT3G61790NP_567118.1 RING-HC_SIAHs 61..99 CDD:319485 13/54 (24%)
Sina 105..304 CDD:397316 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.