DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and SINAT2

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001326739.1 Gene:SINAT2 / 824973 AraportID:AT3G58040 Length:308 Species:Arabidopsis thaliana


Alignment Length:331 Identity:77/331 - (23%)
Similarity:122/331 - (36%) Gaps:118/331 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SSAAAASGMHEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCP 155
            |:.....|:|..  :.:...|.|.||.:|....::||..||.:|:.|        :||.| .|||
plant    40 SAGIGKYGIHSN--NGVYELLECPVCTNLMYPPIHQCPNGHTLCSNC--------KLRVQ-NTCP 93

  Fly   156 NCRVEISKSTASRNLAVEKAASELPSECQF----CNKEFPYKSLERHEQHECQERPTKCKY---- 212
            .||.|:..   .|.||:||.|..|...|::    |:..|||.|..:|||| |:.||..|.|    
plant    94 TCRYELGN---IRCLALEKVAESLEVPCRYQNLGCHDIFPYYSKLKHEQH-CRFRPYTCPYAGSE 154

  Fly   213 -----------------HRI----GCQWRGPYHETNEHE----------------RNCLHPQKSG 240
                             |::    ||.:...|.::|.||                :.|||     
plant   155 CSVTGDIPTLVVHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLH----- 214

  Fly   241 YEV---------MAALEAHDDRIKEEKKMFNTLIDLLSYEKIIFNDLQMKPYRTDEYVHKLFYET 296
            :|.         ||.|....|  :.|.|.|:..:::.::.:                  ||.::.
plant   215 FEAFQLGMAPVYMAFLRFMGD--ENEAKKFSYSLEVGAHGR------------------KLTWQG 259

  Fly   297 ARFSAFNQQWVVKARINNSQRDPHQSNERTITYQLILKTKTSTPMSIHFFALKGPFSDMK--VST 359
                       :...|.:|.|....|.:..|           .|.::..:...|...::|  |:.
plant   260 -----------IPRSIRDSHRKVRDSQDGLI-----------IPRNLALYFSGGDRQELKLRVTG 302

  Fly   360 QIYKHE 365
            :|:|.|
plant   303 RIWKEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 20/54 (37%)
Sina 168..>232 CDD:302762 29/108 (27%)
SINAT2NP_001326739.1 RING-HC_SIAHs 58..96 CDD:319485 17/46 (37%)
Sina 102..301 CDD:397316 50/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.