DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and siah1

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_005159200.1 Gene:siah1 / 80955 ZFINID:ZDB-GENE-010319-31 Length:334 Species:Danio rerio


Alignment Length:326 Identity:73/326 - (22%)
Similarity:113/326 - (34%) Gaps:130/326 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LDTQGSGEPPAKK-QLLDGGGGGATSSSGSSLLSSAAAASGMHEKLAHRISNALCCAVCLDLPKT 122
            |.|..|..||::: ..|.|     |::|.|.|.|       :.|           |.||.|....
Zfish    61 LPTGTSKCPPSQRVPTLSG-----TTASNSDLAS-------LFE-----------CPVCFDYVLP 102

  Fly   123 AMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQF-- 185
            .:.|||.|||:|:.|          |.::..||.||..:.   :.||||:||.|:.:...|::  
Zfish   103 PILQCQSGHLVCSNC----------RPKLTCCPTCRGPLG---SIRNLAMEKVANSVLFPCKYAS 154

  Fly   186 --CNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKS--------- 239
              |....|:.....||: .|:.||..|......|:|:|.......|   .||..||         
Zfish   155 SGCEVTLPHTDKAEHEE-LCEFRPYSCPCPGASCKWQGSLDAVMPH---LLHQHKSITTLQGEDI 215

  Fly   240 ----------------------GYEVMAALEAHDDRIKEEK----KMFNTLIDLLSYEKIIFNDL 278
                                  |:..|..||      |:||    :.|..::.|:...|      
Zfish   216 VFLATDINLPGAVDWVMMQSCFGFHFMLVLE------KQEKYDGHQQFFAIVQLIGTRK------ 268

  Fly   279 QMKPYRTDEYVHKLFYETARFSAFNQQWVVKARINNSQRDPHQSNERTITYQLILKTKTSTPMSI 343
                 :.:.:.::|                  .:|        .:.|.:|::       :||.||
Zfish   269 -----QAENFAYRL------------------ELN--------GHRRRLTWE-------ATPRSI 295

  Fly   344 H 344
            |
Zfish   296 H 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 17/54 (31%)
Sina 168..>232 CDD:302762 20/67 (30%)
siah1XP_005159200.1 Sina 134..330 CDD:281181 43/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.