DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and SIAH2

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_005058.3 Gene:SIAH2 / 6478 HGNCID:10858 Length:324 Species:Homo sapiens


Alignment Length:342 Identity:79/342 - (23%)
Similarity:127/342 - (37%) Gaps:83/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQPPSSSNLPLLGDNQAVATTSSASSASSSSTSSSSSSVGGGNVVGVPLDTQGSGEPPAKKQLLD 75
            |.||...:.|......|.||.|:|...||:..::::       |:..|                 
Human    18 QPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAA-------VISGP----------------- 58

  Fly    76 GGGGGATSSSGSSLLSSAAAASGMHEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTH 140
            |||||            |...|..|    |.:::...|.||.|.....:.|||.|||:|..|   
Human    59 GGGGG------------AGPVSPQH----HELTSLFECPVCFDYVLPPILQCQAGHLVCNQC--- 104

  Fly   141 LLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQF----CNKEFPYKSLERHEQH 201
                   |.:::.||.||..::.|.  ||||:||.||.:...|::    |:....:.....||. 
Human   105 -------RQKLSCCPTCRGALTPSI--RNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHED- 159

  Fly   202 ECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKSGYEVMAALEAHDDRIKEEKKMFNTLID 266
            .|:.||..|......|:|:|.......|   .:|..||    :..|:..|.............:|
Human   160 ICEYRPYSCPCPGASCKWQGSLEAVMSH---LMHAHKS----ITTLQGEDIVFLATDINLPGAVD 217

  Fly   267 LLSYEKIIFNDLQMKPYRTDEYV-HKLFYETARFSAFNQQ---WVVKARINNSQRDPHQSNERTI 327
            .:..:....:...:...:.::|. |:.|:.........:|   :..:..:|        .|.|.:
Human   218 WVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELN--------GNRRRL 274

  Fly   328 TYQLILKTKTSTPMSIH 344
            |::       :||.|||
Human   275 TWE-------ATPRSIH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 17/54 (31%)
Sina 168..>232 CDD:302762 20/67 (30%)
SIAH2NP_005058.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 8/23 (35%)
RING-HC_SIAH2 78..115 CDD:319666 15/46 (33%)
Sina 122..318 CDD:397316 39/188 (21%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 130..322 33/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.