DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and CG34375

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:355 Identity:77/355 - (21%)
Similarity:119/355 - (33%) Gaps:115/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SSAAAASGMHEK--------LAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRL 147
            :|.|...|::::        |.| ||..|.|.|||::.|...:||..||::|..|          
  Fly   101 ASHAVQHGINQQSLQKFATCLQH-ISQLLECPVCLEVIKPPGWQCCNGHVLCNNC---------- 154

  Fly   148 RDQIATCPNCRVEISKSTASRNLAVEK----AASELPSECQFCNKEFPYKSLERHEQHECQERPT 208
            |.:...||.|||.:  ....|.|..:|    .|...|.:....||      :...:.|.......
  Fly   155 RSRSVKCPVCRVPL--GPRGRCLLSDKLFTLLAESFPCDGGKTNK------VAASQGHGKLSSVN 211

  Fly   209 KC--KYHRIGCQWRGPYHETNEHERNCLHPQKSGYEVMAALEA-------------------HDD 252
            ||  :||.   |.:....:|:..:..|      |.::...||.                   .:.
  Fly   212 KCTNEYHN---QPKMALAKTSSGKSKC------GKQISRQLETVLVDQSPREIRRKSQQGQEQEQ 267

  Fly   253 RIKEEKKMFNTLIDLLSYEKII-------FNDLQMKPYRTDEYVHKLFYETARFSAFNQQWV--- 307
            .::|......|||.:...|..:       .|::.:||..      ||..::.|.:..:|..:   
  Fly   268 AVQEAVLPRCTLIKVQHQEAAVEHFSEEGHNNMLVKPKL------KLSKKSWRITGPDQDGLRCD 326

  Fly   308 VKARINN--SQRDPHQSNERTITYQLILKTKTSTPMSIHFFALKGPFSDMKVSTQIYKHEFTETS 370
            ..|.|||  ..::..|..||                                  |...|| ...|
  Fly   327 EVATINNGVQVQEQQQQQER----------------------------------QQLGHE-KSAS 356

  Fly   371 TESEYYVLPLPDGVG-GSGSSECNRMLANK 399
            :||||.....|.|.. .|.|.:..:.:|||
  Fly   357 SESEYQNYHCPTGKSCSSHSYQLGQPVANK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 18/54 (33%)
Sina 168..>232 CDD:302762 14/69 (20%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080
RING 129..168 CDD:238093 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.