DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and sina

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001287089.1 Gene:sina / 39884 FlyBaseID:FBgn0003410 Length:314 Species:Drosophila melanogaster


Alignment Length:359 Identity:82/359 - (22%)
Similarity:124/359 - (34%) Gaps:148/359 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VATTSSASSASSSSTSSSSSSVGGGNVVGVPLDTQGSGEPPAKKQLLDGGGGGATSSSGSSLLSS 92
            |||.:|.|:.|||:.::||::                                 ||||.||.|||
  Fly    24 VATNTSTSTGSSSAGNTSSAN---------------------------------TSSSSSSSLSS 55

  Fly    93 AAAA-SGMHEKLAHRISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPN 156
            |... :||...|    ::...|.||.|.....:.||..|||:|.:|          |.::..||.
  Fly    56 AGGGDAGMSADL----TSLFECPVCFDYVLPPILQCSSGHLVCVSC----------RSKLTCCPT 106

  Fly   157 CRVEISKSTASRNLAVEKAASELPSECQF----CNKEFPYKSLERHEQHECQERPTKCKYHRIGC 217
            ||..::.   .||||:||.||.:...|:.    |.....|.....||: .|:.||..|......|
  Fly   107 CRGPLAN---IRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEE-TCECRPYLCPCPGASC 167

  Fly   218 QWRGPYHETNEH---------------------------------ERNCLHPQKSGYEVMAALEA 249
            :|:||.....:|                                 .::|.     |:..|..|| 
  Fly   168 KWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCF-----GHHFMLVLE- 226

  Fly   250 HDDRIKEEK----KMFNTLIDLLSYEKIIFNDLQMKPYRTDEYVHKLFYETARFSAFNQQWVVKA 310
                 |:||    :.|..::.|:...|           ..:.:|::|                  
  Fly   227 -----KQEKYDGHQQFFAIVQLIGSRK-----------EAENFVYRL------------------ 257

  Fly   311 RINNSQRDPHQSNERTITYQLILKTKTSTPMSIH 344
            .:|        .|.|.:|::       :.|.|||
  Fly   258 ELN--------GNRRRLTWE-------AMPRSIH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 16/54 (30%)
Sina 168..>232 CDD:302762 22/100 (22%)
sinaNP_001287089.1 Sina 114..310 CDD:281181 43/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.