DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and Siah3

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001121565.1 Gene:Siah3 / 380918 MGIID:2685758 Length:268 Species:Mus musculus


Alignment Length:232 Identity:39/232 - (16%)
Similarity:64/232 - (27%) Gaps:95/232 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQFCNKEFPYKS 194
            |.|:|....||.|                    |..:||....:.:|.:         ..|....
Mouse    32 GQLVCVVNPTHNL--------------------KYVSSRRGITQNSAEQ---------GSFHPHH 67

  Fly   195 LERHEQHECQE-------RP---------------TKCKYHRIGCQWRGPYHETNEHERNCLHPQ 237
            |..|.:|.|..       ||               |.|......|||.|.......|.|. :|  
Mouse    68 LPHHHRHHCHHNHLYQHARPHHLHHQEPGLHNSQVTPCICPLFSCQWEGHLEVVVPHLRQ-IH-- 129

  Fly   238 KSGYEVMAALEAHDDRIKEEKKMFNTLIDLLSYEKIIF--NDLQMKPYRTDEYVHKLFYETARFS 300
                                      .||:|...:|:|  .|:.: |...|..:        ..|
Mouse   130 --------------------------RIDILQGAEIVFLATDMHL-PAPADWII--------MHS 159

  Fly   301 AFNQQWVVKARINNSQRDPHQSNERTITYQLILKTKT 337
            .....:::..|    :::.|:.:.:.....:::.|.|
Mouse   160 CLGHHFLLVLR----KQERHEGHPQFFATMMLIGTPT 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 6/33 (18%)
Sina 168..>232 CDD:302762 16/85 (19%)
Siah3NP_001121565.1 Sina 131..256 CDD:239753 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.