DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and Siah1b

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001295314.1 Gene:Siah1b / 20438 MGIID:108063 Length:282 Species:Mus musculus


Alignment Length:327 Identity:71/327 - (21%)
Similarity:113/327 - (34%) Gaps:132/327 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LDTQGSGEPPAKK--QLLDGGGGGATSSSGSSLLSSAAAASGMHEKLAHRISNALCCAVCLDLPK 121
            |.|..|..||:::  .|.|      |::|.:.|.|       :.|           |.||.|...
Mouse     9 LSTGTSKCPPSQRVPALTD------TTASNNDLAS-------LFE-----------CPVCFDYVL 49

  Fly   122 TAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQF- 185
            ..:.|||.|||:|:.|          |.::..||.||..:.   :.||||:||.|:.:...|:: 
Mouse    50 PPILQCQSGHLVCSNC----------RPKLTCCPTCRGPLG---SIRNLAMEKVANSVLFPCKYS 101

  Fly   186 ---CNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKS-------- 239
               |....|:.....||: .|:.||..|......|:|:|.......|   .:|..||        
Mouse   102 ASGCEITLPHTKKAEHEE-LCEFRPYSCPCPGASCKWQGSLDAVMPH---LMHQHKSITTLQGED 162

  Fly   240 -----------------------GYEVMAALEAHDDRIKEEK----KMFNTLIDLLSYEKIIFND 277
                                   |:..|..||      |:||    :.|..::.|:...|     
Mouse   163 IVFLATDINLPGAVDWVMMQSCFGFHFMLVLE------KQEKYDGHQQFFAIVQLIGTRK----- 216

  Fly   278 LQMKPYRTDEYVHKLFYETARFSAFNQQWVVKARINNSQRDPHQSNERTITYQLILKTKTSTPMS 342
                  :.:.:.::|                  .:|        .:.|.:|::       :||.|
Mouse   217 ------QAENFAYRL------------------ELN--------GHRRRLTWE-------ATPRS 242

  Fly   343 IH 344
            ||
Mouse   243 IH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 17/54 (31%)
Sina 168..>232 CDD:302762 20/67 (30%)
Siah1bNP_001295314.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 5/13 (38%)
Sina 82..278 CDD:281181 42/217 (19%)
SBD 90..282 36/209 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.