DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32486 and Siah1a

DIOPT Version :9

Sequence 1:NP_647765.1 Gene:CG32486 / 38367 FlyBaseID:FBgn0266918 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_006530847.3 Gene:Siah1a / 20437 MGIID:108064 Length:355 Species:Mus musculus


Alignment Length:406 Identity:85/406 - (20%)
Similarity:137/406 - (33%) Gaps:168/406 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSSAVQQPPSSSNLPL---LGDNQA-----VATTSSASS-------------------ASSSSTS 43
            ::.|.:..|.|:.|||   .|..||     |.|..:|:.                   |...|..
Mouse    13 AAPAFKPKPCSAQLPLRDSSGSLQAPRCNLVCTPWAAADRLFLERYRICLPWHKSYICAFEMSRQ 77

  Fly    44 SSSSSVGGGNVVGVPLDTQGSGEPPAKK-QLLDGGGGGATSSSGSSLLSSAAAASGMHEKLAHRI 107
            ::::           |.|..|..||::: ..|.|     |::|.:.|.|       :.|      
Mouse    78 TATA-----------LPTGTSKCPPSQRVPALTG-----TTASNNDLAS-------LFE------ 113

  Fly   108 SNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAV 172
                 |.||.|.....:.|||.|||:|:.|          |.::..||.||..:.   :.||||:
Mouse   114 -----CPVCFDYVLPPILQCQSGHLVCSNC----------RPKLTCCPTCRGPLG---SIRNLAM 160

  Fly   173 EKAASELPSECQF----CNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNC 233
            ||.|:.:...|::    |....|:.....||: .|:.||..|......|:|:|.......|   .
Mouse   161 EKVANSVLFPCKYASSGCEITLPHTEKAEHEE-LCEFRPYSCPCPGASCKWQGSLDAVMPH---L 221

  Fly   234 LHPQKS-------------------------------GYEVMAALEAHDDRIKEEK----KMFNT 263
            :|..||                               |:..|..||      |:||    :.|..
Mouse   222 MHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLE------KQEKYDGHQQFFA 280

  Fly   264 LIDLLSYEKIIFNDLQMKPYRTDEYVHKLFYETARFSAFNQQWVVKARINNSQRDPHQSNERTIT 328
            ::.|:...|           :.:.:.::|                  .:|        .:.|.:|
Mouse   281 IVQLIGTRK-----------QAENFAYRL------------------ELN--------GHRRRLT 308

  Fly   329 YQLILKTKTSTPMSIH 344
            ::       :||.|||
Mouse   309 WE-------ATPRSIH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32486NP_647765.1 zf-C3HC4_3 109..164 CDD:290631 17/54 (31%)
Sina 168..>232 CDD:302762 20/67 (30%)
Siah1aXP_006530847.3 RING-HC_SIAH1 112..151 CDD:319665 18/59 (31%)
Sina 155..351 CDD:367355 42/217 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.