DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16753 and SLX9

DIOPT Version :9

Sequence 1:NP_647764.1 Gene:CG16753 / 38365 FlyBaseID:FBgn0035393 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_478070.1 Gene:SLX9 / 85395 HGNCID:15811 Length:230 Species:Homo sapiens


Alignment Length:177 Identity:45/177 - (25%)
Similarity:85/177 - (48%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKKNVRAKAKSVVGAAKQKAQDMKAKLREDRLLHKTLTPKKTTTKKEKSEAKHKKLLKRFAEAR 67
            |.:.:||:......|.|...|:.:.:..|....  ||:.|     ||||.:.:.::.|::. ||.
Human    66 KLELDVRSVTSVRRGEAGSSARSVPSIRRGAEA--KTVLP-----KKEKMKLRREQWLQKI-EAI 122

  Fly    68 KKRKEEH---KNREKTKVVGDLKPLRDALPSLQDI----YKLVKTKQKDVSEGAALTEPEVRLSA 125
            |..:::|   :.|..|.|||||.|||||||.|..:    .:..::::.:....:.|:    |:||
Human   123 KLAEQKHREERRRRATVVVGDLHPLRDALPELLGLEAGSRRQARSRESNKPRPSELS----RMSA 183

  Fly   126 NEK---IRKKRTEMVNTVKSFEKLIKDKNFKKNPREVIAAHVRNKYQ 169
            .::   :.::||.       |::|:....::.:|...|...:..:.|
Human   184 AQRQQLLEEERTR-------FQELLASPAYRASPLVAIGQTLARQMQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16753NP_647764.1 SLX9 54..167 CDD:291986 30/122 (25%)
SLX9NP_478070.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
SLX9 99..221 CDD:317712 37/138 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..187 4/35 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108134
Panther 1 1.100 - - LDO PTHR31109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10237
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.