DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16753 and AT2G01640

DIOPT Version :9

Sequence 1:NP_647764.1 Gene:CG16753 / 38365 FlyBaseID:FBgn0035393 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001189496.1 Gene:AT2G01640 / 814693 AraportID:AT2G01640 Length:156 Species:Arabidopsis thaliana


Alignment Length:144 Identity:31/144 - (21%)
Similarity:63/144 - (43%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PKKTTTKKEKSEAKHKKLLKRFAEARKK-----------RKEEHKNREKTKVVGDLKPLRDALPS 95
            |.|.:....||:.|.:|.|:.:.:.:..           :|::.::|:|.....||..|.:.||.
plant     4 PSKGSEVTTKSDKKFEKKLQFYTKVKDTVTSLSVQKEIGKKKKIRSRQKKLKAYDLTNLSEFLPE 68

  Fly    96 LQDIYKLVKTKQKDVSEGAALTEPEVRLSANEKIRKKRTEMVNTV-KSFEKLIKDKNFKKNPREV 159
            ...:.|            :||..||::::.     |:|.::|.|. :...|::....|:.:|...
plant    69 FNALQK------------SALPAPELKMNC-----KRRQKLVLTEGERLNKVLDHPAFQADPVGS 116

  Fly   160 IAAHVRNKYQAMEE 173
            |..|:.::...:||
plant   117 IFQHLLSQQPPVEE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16753NP_647764.1 SLX9 54..167 CDD:291986 25/124 (20%)
AT2G01640NP_001189496.1 SLX9 10..121 CDD:405926 26/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31109
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.