DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16753 and Slx9

DIOPT Version :9

Sequence 1:NP_647764.1 Gene:CG16753 / 38365 FlyBaseID:FBgn0035393 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001008308.1 Gene:Slx9 / 294333 RGDID:1311257 Length:219 Species:Rattus norvegicus


Alignment Length:143 Identity:42/143 - (29%)
Similarity:71/143 - (49%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LHKTLTPKKTTTKKEKSEAKHKKLLKRFAEARK---KRKEEHKNREKTKVVGDLKPLRDALPSLQ 97
            |.:...||....||||.:.:.::.|::. ||.|   ::..|.:.|..|.|||||.|||||||.||
  Rat    80 LKRGAEPKAIVPKKEKLKLRRERWLQKI-EAIKLADQKLREERRRRATVVVGDLHPLRDALPELQ 143

  Fly    98 DIYKLVKTKQKDVSEGAALTEPEVRLS------ANEKIRKKRTEMVNTVKSFEKLIKDKNFKKNP 156
            :: :..:.:|:....|.:...| |.||      ..:.:.::||.       |:||:....::.:|
  Rat   144 EL-EAGRQQQQPRRRGTSKPRP-VELSRMSTAQRQQLLEEERTR-------FQKLLASPAYRASP 199

  Fly   157 REVIAAHVRNKYQ 169
            ...|...:.::.|
  Rat   200 LLAIGQQLAHQMQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16753NP_647764.1 SLX9 54..167 CDD:291986 34/121 (28%)
Slx9NP_001008308.1 SLX9 87..210 CDD:291986 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108134
Panther 1 1.100 - - LDO PTHR31109
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.