DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and RPT1

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_012777.1 Gene:RPT1 / 853712 SGDID:S000001628 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:67/354 - (18%)
Similarity:116/354 - (32%) Gaps:117/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDK------------------DVEHITDVTS 234
            ::|.|::.:.::....||...|  |...:|.|..|.|                  .||...|||.
Yeast   146 VINLKQIAKFVVGLGERVSPTD--IEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTY 208

  Fly   235 STATGLYDPFTLSWSPLISWLFGINSKI-----LPRVVDNGYKGFGHVHPTA---FGPDWANTEI 291
            |...|..|..               .|:     ||.:....:...|...|..   :||......:
Yeast   209 SDVGGCKDQI---------------EKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTL 258

  Fly   292 PIAASLSDQTAA----IWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPT 352
             .|.:::::|.|    :.||:..||     .:|.||           .::..::.:..      |
Yeast   259 -CARAVANRTDATFIRVIGSELVQK-----YVGEGA-----------RMVRELFEMAR------T 300

  Fly   353 RQQGAVY-----CIEGASHDFG---------TVVTWAQSCELFDSPANTSDI-AQSVPDTND--- 399
            ::...::     .:.||..|.|         |::......:.||...|...: |.:.|:|.|   
Yeast   301 KKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPAL 365

  Fly   400 ----------VFFMPAFSGLGPPVNDYRSASGFIG------------LTPSTTKAHMVRALLESI 442
                      .|.:|...|   ..|.:|..|..:.            |.|::|.|.:.....|:.
Yeast   366 LRPGRIDRKVEFSLPDLEG---RANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAG 427

  Fly   443 VFRLVQLIEAAEKETSQKLHMIRVDGGVS 471
            :|    .|.|..|..::|..:..||..:|
Yeast   428 MF----AIRARRKVATEKDFLKAVDKVIS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 67/354 (19%)
FGGY_GK5_metazoa 32..552 CDD:212665 67/354 (19%)
RPT1NP_012777.1 RPT1 28..464 CDD:224143 67/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.