DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and RPT2b

DIOPT Version :10

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_179604.1 Gene:RPT2b / 816533 AraportID:AT2G20140 Length:443 Species:Arabidopsis thaliana


Alignment Length:81 Identity:17/81 - (20%)
Similarity:28/81 - (34%) Gaps:27/81 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KPAGAAKDSQCAEESGP-------------PDSPAFILALDVGTTC---------VRSFVLDEQC 52
            ||.|..|..:..|.:.|             |::.|.:..:...|.|         ::.::|.|: 
plant    16 KPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTKCKLRLLKLERIKDYLLMEE- 79

  Fly    53 EVRGSAVDAVELLNPQ 68
                ..|...|.|.||
plant    80 ----EFVANQERLKPQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 ASKHA_NBD_FGGY_GK5-like 32..549 CDD:466803 9/46 (20%)
RPT2bNP_179604.1 PTZ00361 7..443 CDD:185575 17/81 (21%)

Return to query results.
Submit another query.