DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Katnal2

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001355584.1 Gene:Katnal2 / 71206 MGIID:1924234 Length:539 Species:Mus musculus


Alignment Length:182 Identity:38/182 - (20%)
Similarity:63/182 - (34%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSKVAAKPAGAAKDS------QCAEESGPPDSPAFILALDVGTT--------CVRSFVLDEQCEV 54
            ||:...|......||      .|.::|.|..|     |:..|.|        .|:..|.|.|.|.
Mouse   102 PSRSGGKNKRLTNDSCQNLPKICHQKSRPKTS-----AVKTGDTKSVKEHLKQVKESVTDTQAES 161

  Fly    55 RGSAVDAVELLNPQPGYFEIEPESLWRKIV---GVITQAVKNAQLTPPDITCLTISTQRC----- 111
            ....::..::...||   |.:.:....:|:   |:::.|:|.|      .:...::|..|     
Mouse   162 TDFGLNISKIHKDQP---EEKAQPRRGQIIDFRGLLSDAIKGA------TSEFALNTFECNPDPS 217

  Fly   112 --------TFLTWDHRSGE---------YYHN-FITWKDL----RADELVDQ 141
                    .|:..:....|         |.|| .|.|.|:    .|.:||.:
Mouse   218 ERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 29/148 (20%)
FGGY_GK5_metazoa 32..552 CDD:212665 29/148 (20%)
Katnal2NP_001355584.1 LisH 25..55 CDD:128913
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..121 5/18 (28%)
SpoVK <239..523 CDD:223540 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.