Sequence 1: | NP_647763.1 | Gene: | CG1271 / 38364 | FlyBaseID: | FBgn0035392 | Length: | 556 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262276.1 | Gene: | Kat60 / 53566 | FlyBaseID: | FBgn0040208 | Length: | 605 | Species: | Drosophila melanogaster |
Alignment Length: | 248 | Identity: | 44/248 - (17%) |
---|---|---|---|
Similarity: | 89/248 - (35%) | Gaps: | 74/248 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 GPPDSPAFILALDVGTTCVRSFV--------------------------------------LDEQ 51
Fly 52 CEVRGSAVD-------AVELLNPQPGYFEIEPESLWRKIVGVITQAVKNAQLTPPDI-TCLTIST 108
Fly 109 QRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYA-LFLLTRQSRFLAGSV 172
Fly 173 LQLMNGQVTPRLLFEI--------MNNKKLKQALMQ-----KKARVELLDSWI 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1271 | NP_647763.1 | GlpK | 32..555 | CDD:223628 | 41/241 (17%) |
FGGY_GK5_metazoa | 32..552 | CDD:212665 | 41/241 (17%) | ||
Kat60 | NP_001262276.1 | HCV_NS5a_C | <163..243 | CDD:289693 | |
P-loop_NTPase | 325..>381 | CDD:304359 | 6/14 (43%) | ||
AAA | 358..496 | CDD:214640 | 27/137 (20%) | ||
AAA | 362..495 | CDD:278434 | 27/136 (20%) | ||
Vps4_C | <570..603 | CDD:286426 | 5/30 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0554 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |