DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Rpt2

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:209 Identity:38/209 - (18%)
Similarity:73/209 - (34%) Gaps:76/209 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 QVTP--RLLFEIMNNKKLKQALM--------------------QKKARVELL------------- 208
            ||||  |...:::..:::|..||                    :::::|:.|             
  Fly    50 QVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGNLEEI 114

  Fly   209 --DSWILHKLRTGSSR--------DKD-------------VEHITDVTSSTATGLYDPFTLSWSP 250
              |:..:.....||..        |||             |..:..|.|.....:.....|..:|
  Fly   115 IDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAP 179

  Fly   251 LISW--LFGINSKI--------LPRVVDNGYKGFGHVHPTA---FGPDWANTEIPIAASLSDQTA 302
            ..::  :.|::::|        ||......|:..|...|..   :||......: :|.::::||:
  Fly   180 QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTL-LAKAVANQTS 243

  Fly   303 A----IWGSQCFQK 312
            |    :.||:..||
  Fly   244 ATFLRVVGSELIQK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 38/209 (18%)
FGGY_GK5_metazoa 32..552 CDD:212665 38/209 (18%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 38/209 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.