DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and kat-60L1

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:374 Identity:66/374 - (17%)
Similarity:121/374 - (32%) Gaps:122/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 SSMNWFSYALFLLTRQSRFLAGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWIL 213
            |:.|||.     :.:.:...:|.|.||:|            ||..|.....|:.|..:  .|::.
  Fly     5 SAQNWFG-----MGQTAVDPSGGVAQLLN------------NNSSLYNQQQQQAAAAQ--HSFMR 50

  Fly   214 HKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKGFGHVH 278
            .:..|.|:      .:...:::.||....|      |.:...:.:....:|......|.....:|
  Fly    51 QRSLTSSN------PVLGRSNALATRPQSP------PNVQVEYEVAVPFVPTYRHTPYHSLWDLH 103

  Fly   279 PTAFGPDWANTEIPIAASLSDQ-----------TAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDR 332
            ..:..|.   |.:...|.:.|.           |.....|:..:...:|.:...|   :..|.:|
  Fly   104 QCSSTPP---TSLSHMARMMDSLILDSLSPFGFTKITATSRPSRNASLKKSSEGG---HSSTAER 162

  Fly   333 CQAV------------ISGMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVV--------TWAQS 377
            .:.|            |.|..||.:.| :.||:...|....:..:.....:.        .|..|
  Fly   163 HRPVNNLGSNAPGGLGIGGSVPLRSKQ-RLPTQVSAAEVAPQPRASQTAQMPFPSQQQDNRWVSS 226

  Fly   378 CELFD-----------SPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYRSASGFIGL------ 425
            ....|           |.||:|.::||                      :..::|.:||      
  Fly   227 LRRRDPELQPTLPSINSNANSSSLSQS----------------------HHGSAGNVGLAGAGAP 269

  Fly   426 TPSTT-----------KAHMVRALLESIVFRLVQLIEAAEKETSQKLHM 463
            ||:.:           .:.|..||.:|   |.|:.:.|.:..|:.:|::
  Fly   270 TPAASMGTMRLGRPARASAMTAALRKS---RSVERLRARKLSTNTQLNL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 66/374 (18%)
FGGY_GK5_metazoa 32..552 CDD:212665 66/374 (18%)
kat-60L1NP_001163523.1 AAA 426..565 CDD:214640
AAA 430..563 CDD:278434
Vps4_C <638..671 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.