Sequence 1: | NP_647763.1 | Gene: | CG1271 / 38364 | FlyBaseID: | FBgn0035392 | Length: | 556 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956327.1 | Gene: | psmc1a / 336786 | ZFINID: | ZDB-GENE-030131-8730 | Length: | 440 | Species: | Danio rerio |
Alignment Length: | 243 | Identity: | 41/243 - (16%) |
---|---|---|---|
Similarity: | 87/243 - (35%) | Gaps: | 85/243 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 ESGPPDSPAFILALDVGTTCVRSFVLDEQC-EVRGSAVDAVELLNPQPGYFE---IEP------- 76
Fly 77 ------------------ESLWRKIVG-------------VITQAVKNAQLTPPDITCL----TI 106
Fly 107 STQRCTFLTWDHRSG---EYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFL 168
Fly 169 AGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHKL 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1271 | NP_647763.1 | GlpK | 32..555 | CDD:223628 | 38/234 (16%) |
FGGY_GK5_metazoa | 32..552 | CDD:212665 | 38/234 (16%) | ||
psmc1a | NP_956327.1 | PTZ00361 | 25..440 | CDD:185575 | 41/243 (17%) |
Prot_ATP_ID_OB | 108..>176 | CDD:293059 | |||
AAA | 222..355 | CDD:278434 | 19/152 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0554 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |