DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and CG10793

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:359 Identity:77/359 - (21%)
Similarity:111/359 - (30%) Gaps:100/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DPFTLSWSPLISWLFGINSKILPRVVDNGYK-----GFGHVHPTAFGPDWANTEIPIAASLSDQT 301
            |...|.::...:..||...|||.:|   |.|     |.|..|...     ...|:|.....:|.:
  Fly    71 DAMYLEYASFYNMKFGKYPKILKKV---GAKIKVEMGGGKAHEKT-----PAKELPKKPPTTDAS 127

  Fly   302 AAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQGAVYCIE---- 362
            .|.|            .:|.||         ....:|...||...:.:..|...|.....|    
  Fly   128 LANW------------HIGVGA---------ATQALSNEQPLQIKKMETATESNGQDNACEIEHV 171

  Fly   363 --GASHDFGTVVTWAQSCELFDSPANTSDIAQSVPDT---------------NDVFFMPAFS-GL 409
              |......:.:.|....||..:.....:|.....|.               ..:.|...|: ||
  Fly   172 HLGGDDVLFSSLEWQSLAELVKTSILQENIKIKWSDVCGNQRAIELIKEAVLTPIEFPQLFAHGL 236

  Fly   410 ---------GPPVND--------YRSASG---FIGLTPSTTKAHMV---RALLESIVFRLVQLIE 451
                     |||.:.        |....|   |..:|.|.    ||   |...|.|   |..|..
  Fly   237 KPWRSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITASI----MVSKWRGESEKI---LRVLFH 294

  Fly   452 AAEKETSQKLHMIRVDGGVSRNDFVC------QFLADLSRLRVERADNAESSIMGATFMAGINLG 510
            .|.|.....:....::...|:.|...      :|..:|.:|    .|..|.|:.|...:|..||.
  Fly   295 MAAKRAPSVIFFDEIESLTSKRDRATDHESSKRFKNELLQL----LDGMEHSLNGVFVLASTNLP 355

  Fly   511 IWRDVND--LKRFRKVARVFEPRPKEYETIANRM 542
             | |:::  |:||.|...|..|...|...:.||:
  Fly   356 -W-DIDEAFLRRFEKKLLVQLPNAAERSCLINRL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 77/359 (21%)
FGGY_GK5_metazoa 32..552 CDD:212665 77/359 (21%)
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 8/53 (15%)
AAA 238..376 CDD:214640 36/150 (24%)
AAA 242..374 CDD:278434 36/144 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.