DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Katnal1

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001006957.1 Gene:Katnal1 / 288449 RGDID:1359252 Length:488 Species:Rattus norvegicus


Alignment Length:174 Identity:38/174 - (21%)
Similarity:62/174 - (35%) Gaps:58/174 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 LFDSPANTSD--IAQSV-PDTNDVFFMPAFSGLGPPVNDYRSASGFIGLTPSTTKAHMVRALLES 441
            |...|..|..  :|::| .:....||..:.|.|   .:.||..|           ..:||.|.|.
  Rat   243 LMVGPPGTGKTMLAKAVATECGTTFFNVSSSTL---TSKYRGES-----------EKLVRLLFEM 293

  Fly   442 IVFRLVQLI-------------EAAEKETSQKLH---MIRVD--GGVSRNDFVCQFLADLSRLRV 488
            ..|.....|             .:.|.|.|:::.   :|::|  ||...||       |.|::.:
  Rat   294 ARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALEND-------DPSKMVM 351

  Fly   489 ERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVARVFEPRP 532
                     ::.||...      | |:::..|.|...|::.|.|
  Rat   352 ---------VLAATNFP------W-DIDEALRRRLEKRIYIPLP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 38/174 (22%)
FGGY_GK5_metazoa 32..552 CDD:212665 38/174 (22%)
Katnal1NP_001006957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..179
RecA-like_KTNA1 207..376 CDD:410930 36/169 (21%)
AAA_lid_3 400..444 CDD:407720
Vps4_C <448..486 CDD:401324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.