DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Psmc2

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001355590.1 Gene:Psmc2 / 19181 MGIID:109555 Length:433 Species:Mus musculus


Alignment Length:257 Identity:53/257 - (20%)
Similarity:89/257 - (34%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDK------------------DVEHITDVTS 234
            |:|.|:..:.::....:|...|  |...:|.|..|:|                  .||...|||.
Mouse   112 IINVKQFAKFVVDLSDQVAPTD--IEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTY 174

  Fly   235 STATGLYDPF----TLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEIPIAA 295
            |...|..:..    .:..:||:.....:|..|.|.      ||.     ..|||......: .|.
Mouse   175 SDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPP------KGV-----LLFGPPGTGKTL-CAR 227

  Fly   296 SLSDQTAA----IWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQG 356
            :::::|.|    :.||:..||     .:|.||           .::..::.:..      |::..
Mouse   228 AVANRTDACFIRVIGSELVQK-----YVGEGA-----------RMVRELFEMAR------TKKAC 270

  Fly   357 AVY-----CIEGASHDFG---------TVVTWAQSCELFDSPANTSDI-AQSVPDTNDVFFM 403
            .::     .|.||..|.|         |::......:.||...|...: |.:.|||.|...|
Mouse   271 LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALM 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 53/257 (21%)
FGGY_GK5_metazoa 32..552 CDD:212665 53/257 (21%)
Psmc2NP_001355590.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
RPT1 23..430 CDD:224143 53/257 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.