DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and Psmc1

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_032973.1 Gene:Psmc1 / 19179 MGIID:106054 Length:440 Species:Mus musculus


Alignment Length:243 Identity:43/243 - (17%)
Similarity:87/243 - (35%) Gaps:85/243 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESGPPDSPAFILALDVGTTCVRSFVLDEQC-EVRGSAVDAVELLNPQPGYFE---IEP------- 76
            |..|.::.|     |:|.       ||.|. |::    ::|||....|.|:|   |:|       
Mouse   177 EKAPQETYA-----DIGG-------LDNQIQEIK----ESVELPLTHPEYYEEMGIKPPKGVILY 225

  Fly    77 ------------------ESLWRKIVG-------------VITQAVKNAQLTPPDITCL----TI 106
                              .:.:.::||             ::.:..:.|:...|.|..:    .|
Mouse   226 GPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAI 290

  Fly   107 STQRCTFLTWDHRSG---EYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFL 168
            .|:|     :|..||   |.....:        ||::|.:...::..:.     :.:.|.:...|
Mouse   291 GTKR-----YDSNSGGEREIQRTML--------ELLNQLDGFDSRGDVK-----VIMATNRIETL 337

  Fly   169 AGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHKL 216
            ..::::  .|::..::.|.:.:.|..|:......:|:.|.|...|..|
Mouse   338 DPALIR--PGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 40/234 (17%)
FGGY_GK5_metazoa 32..552 CDD:212665 40/234 (17%)
Psmc1NP_032973.1 PTZ00361 1..440 CDD:185575 43/243 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.