DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1271 and rpt-2

DIOPT Version :9

Sequence 1:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 / 178988 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans


Alignment Length:247 Identity:44/247 - (17%)
Similarity:89/247 - (36%) Gaps:90/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESGPPDSPAFILALDVGTTCVRSFVLDEQC-EVRGSAVDAVELLNPQPGYFE---IEP------- 76
            |..|.::.|     |||.       ||:|. |::    :||||....|.|:|   |.|       
 Worm   180 EKAPQETYA-----DVGG-------LDQQIQEIK----EAVELPLTHPEYYEEMGIRPPKGVILY 228

  Fly    77 ------------------ESLWRKIVG-------------VITQAVKNAQLTPPDITCL----TI 106
                              .:.:.:|||             ::.:..:.|:...|.|..:    .:
 Worm   229 GCPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKMVRELFRVAEENAPSIVFIDEIDAV 293

  Fly   107 STQRCTFLTWDHRSG---EYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFL 168
            .|:|     :|..||   |.....:        ||::|.:...::..:.     :.:.|.:...|
 Worm   294 GTKR-----YDSNSGGEREIQRTML--------ELLNQLDGFDSRGDVK-----VLMATNRIESL 340

  Fly   169 AGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVEL-----LDSWILHK 215
            ..::::  .|::..::.|.:.:.|..::......:|:.|     |:.:|..|
 Worm   341 DPALIR--PGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLGKEVNLEEFITAK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1271NP_647763.1 GlpK 32..555 CDD:223628 41/238 (17%)
FGGY_GK5_metazoa 32..552 CDD:212665 41/238 (17%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 44/247 (18%)
Prot_ATP_ID_OB 112..>179 CDD:293059
AAA 225..358 CDD:278434 19/152 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.