DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and PDR16

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_014168.1 Gene:PDR16 / 855490 SGDID:S000005175 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:57/220 - (25%)
Similarity:89/220 - (40%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEM 73
            :|.|.|.|:|..|..:..:        ...|||||.| ...|....|..|..||..:|:..|.|.
Yeast    70 SEDDLKPLEEEEKAWLTRE--------CFLRYLRATKWVLKDCIDRITMTLAWRREFGISHLGEE 126

  Fly    74 --DRSQLD---------KKARLLRHRDCIGRPVIYI-PAKNH--SSERDIDELTRFIVYNLEEAC 124
              |:...|         |:..|....|  .||::|: |.:.:  :|.|.:..|    |:.||...
Yeast   127 HGDKITADLVAVENESGKQVILGYEND--ARPILYLKPGRQNTKTSHRQVQHL----VFMLERVI 185

  Fly   125 KKCFEEVTDRLCIVFDLAEF--------STSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLF 181
             .......|.|.::.|..::        ::......:.:.::.:|..|:|||||..|:.|.|.|.
Yeast   186 -DFMPAGQDSLALLIDFKDYPDVPKVPGNSKIPPIGVGKEVLHILQTHYPERLGKALLTNIPWLA 249

  Fly   182 STIWPAIRVLLDDNTAKKVKFVADE 206
            .|....|...:|..|.:|:.|  ||
Yeast   250 WTFLKLIHPFIDPLTREKLVF--DE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 33/133 (25%)
PDR16NP_014168.1 CRAL_TRIO_N 47..109 CDD:397711 13/46 (28%)
CRAL_TRIO 142..290 CDD:395525 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45824
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.