DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and YKL091C

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:57/240 - (23%)
Similarity:109/240 - (45%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDA-FQAILKTNKWRETYGVDKLSE 72
            :.::..:.|.:...:::|.:.|:..:|.:|.|:|||.|...:| .:..::|.:|||.||.:.:.|
Yeast    25 LTKEQEEALLQFRSILLEKNYKERLDDSTLLRFLRARKFDINASVEMFVETERWREEYGANTIIE 89

  Fly    73 --MDRSQLDKKARL---------LRHRDCIGRPVIY-------------IPAKNHSSERDIDELT 113
              .:..:.:.|.|:         ..|.|..|||:.:             |..:.......:.|..
Yeast    90 DYENNKEAEDKERIKLAKMYPQYYHHVDKDGRPLYFEELGGINLKKMYKITTEKQMLRNLVKEYE 154

  Fly   114 RFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQL--VQNLIWLLGKHFPERLGVCLIIN 176
            .|..|.: .||.:....:.:..|.|.||...|.|...:.|  ::::..:...::|||:|...||:
Yeast   155 LFATYRV-PACSRRAGYLIETSCTVLDLKGISLSNAYHVLSYIKDVADISQNYYPERMGKFYIIH 218

  Fly   177 SPGLFSTIWPAIRVLLDDNTAKKVKFVAD--EAELCQYLIPDILP 219
            ||..|||::..::..||..|..|:..:..  :.||.:.:..:.||
Yeast   219 SPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 35/150 (23%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 11/44 (25%)
SEC14 101..271 CDD:214706 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53872
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.